anti-Integrin alpha 3B, Alexa Fluor 488, Clone: PB36, Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP197731AF488

Catalog No. NBP197731X

Description

Integrin alpha 3B Monoclonal specifically detects Integrin alpha 3B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen.

Specifications

• Antigen: Integrin alpha 3B
• Classification: Monoclonal
• Conjugate: Alexa Fluor 488
• Gene Alias: AA407068, CD49C, GAPB3, integrin alpha 3
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3675
• Target Species: Human
• Isotype: IgG1

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
• Clone: PB36
• Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
• Gene Symbols: ITGA3
• Immunogen: Clone PB36 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha 3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
• Content And Storage: Store at 4C in the dark.

For Research Use Only