anti-MRPL10, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP182858

Catalog No. NBP182858

Description

MRPL10 Polyclonal antibody specifically detects MRPL10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRPL10
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: L10mt, MGC17973, mitochondrial ribosomal protein L10, MRP-L10L8mt, MRP-L839S ribosomal protein L10, mitochondrial, MRPL839S ribosomal protein L8, mitochondrial, RPML8L10MT
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 0.1 ml
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
• Format: Affinity Purified
• Gene Symbols: MRPL10
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGC
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 124995
• Target Species: Human

For Research Use Only