Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRPL27 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP187553
Description
MRPL27 Polyclonal specifically detects MRPL27 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MRPL41 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Bcl-2-interacting mitochondrial ribosomal protein L41,39S ribosomal protein L41, mitochondrial, BMRPMRP-L41, Cell proliferation-inducing gene 3 protein, mitochondrial ribosomal protein L41,39S ribosomal protein L27 homolog, MRP-L27, MRPL27L41mt, PIG3, proliferation-inducing gene 3, RPML27MRP-L27 homolog | |
Rabbit | |
Affinity Purified | |
RUO | |
64975 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
MRPL41 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:HPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction