Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTO1 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154767

Catalog No. NBP154767

Add to cart



MTO1 Polyclonal antibody specifically detects MTO1 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to MTO1(mitochondrial translation optimization 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of MTO1 (NP_001116698). Peptide sequence STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV.
81 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 0.2-1 ug/ml
EC, EC 6.3.5, homolog of yeast Mto1, mitochondrial MTO1-3, mitochondrial translation optimization 1 homolog (S. cerevisiae), protein MTO1 homolog, mitochondrial
Immunogen affinity purified
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only