Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Muscleblind-like 1 Rabbit anti-Human, Mouse, Rat, Porcine, Canine, Equine, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180488

Catalog No. NBP180488


Add to cart

Description

Description

Muscleblind-like 1 Polyclonal antibody specifically detects Muscleblind-like 1 in Human, Mouse, Rat, Porcine, Canine, Equine, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

Muscleblind-like 1
LYOPH
Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Q9NR56
DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein
Rabbit
IgG
50 ul
Chromatin Research, DNA replication Transcription Translation and Splicing
Primary
4154
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
MBNL1
Synthetic peptide directed towards the middle region of human MBNL1 (AAH50535). Peptide sequence AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI.
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%; Zebrafish: 100%.
Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only