Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-MX2, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody



Host Species Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Antigen MX2
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
0.1 ml
Each for $542.50
Add to cart


MX2 Polyclonal antibody specifically detects MX2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.


This antibody was developed against Recombinant Protein corresponding to amino acids:PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Product Certifications

For Research Use Only

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit