N-acetylglutamate synthase, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NAGS.

Manufacturer:  Abnova Corporation H00162417A01

Catalog No. 89-004-807

Description

The N-acetylglutamate synthase gene encodes a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. This gene may regulate ureagenesis by altering NAG availability and, thereby, CPSI activity. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia. [provided by RefSeq

Sequence: VLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDP

Specifications

• Antigen: N-acetylglutamate synthase
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_153006
• Gene Alias: AGAS|ARGA|MGC133025
• Host Species: Mouse
• Quantity: 50 uL
• Research Discipline: Kinases
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant NAGS.
• Gene: NAGS
• Format: Serum
• Gene Symbols: NAGS
• Immunogen: NAGS (NP_694551, 435 a.a. ~ 532 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 162417