NASP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152914

Catalog No. NBP152914

Description

NASP Polyclonal specifically detects NASP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NASP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp547F162, FLB7527, FLJ31599, FLJ35510, histone H1-binding protein, MGC19722, MGC20372, MGC2297, nuclear autoantigenic sperm protein, nuclear autoantigenic sperm protein (histone-binding), PRO1999
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers
• Gene ID (Entrez): 4678
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q5T626
• Gene Symbols: NASP
• Immunogen: Synthetic peptides corresponding to NASP(nuclear autoantigenic sperm protein (histone-binding)) The peptide sequence was selected from the middle region of NASP. Peptide sequence KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.