Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NASP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP152914
Description
NASP Polyclonal specifically detects NASP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NASP | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp547F162, FLB7527, FLJ31599, FLJ35510, histone H1-binding protein, MGC19722, MGC20372, MGC2297, nuclear autoantigenic sperm protein, nuclear autoantigenic sperm protein (histone-binding), PRO1999 | |
Rabbit | |
49 kDa | |
100 μL | |
Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers | |
4678 | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Q5T626 | |
NASP | |
Synthetic peptides corresponding to NASP(nuclear autoantigenic sperm protein (histone-binding)) The peptide sequence was selected from the middle region of NASP. Peptide sequence KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction