Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NAT13 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155172

Catalog No. NBP155172


Add to cart

Description

Description

NAT13 Polyclonal antibody specifically detects NAT13 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

NAT13
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
NAA50
Synthetic peptides corresponding to NAT13(N-acetyltransferase 13) The peptide sequence was selected from the C terminal of NAT13. Peptide sequence AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN.
19 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Mouse: 86%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Western Blot
Western Blot 1:100-1:2000
Q9GZZ1
EC 2.3.1.-, FLJ13194, hSAN, Mak3 homolog (S. cerevisiae), N(alpha)-acetyltransferase 50, NatE catalytic subunit, N-acetyltransferase 13 (GCN5-related), N-acetyltransferase 5, N-acetyltransferase san homolog, NAT13San, NAT5SAN, NatE catalytic subunit, separation anxiety
Rabbit
IgG
Protein A purified
RUO
Primary
80218
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only