anti-NCOA7, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP185202

Catalog No. NBP185202

Description

NCOA7 Polyclonal antibody specifically detects NCOA7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NCOA7
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 140 kDa estrogen receptor-associated protein, dJ187J11.3, ERAP140Nbla00052, ESNA1, Estrogen nuclear receptor coactivator 1, estrogen receptor associated protein 140 kDa, FLJ45605, MGC88425, Nbla10993, nuclear receptor coactivator 7, putative protein product of Nbla00052, putative protein product of Nbla10993
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 0.1 ml
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Format: Affinity Purified
• Gene Symbols: NCOA7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NDVELKGALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENLQKTELSDG
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 135112
• Target Species: Human

For Research Use Only