Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NDUFA8 protein.

Manufacturer:  Abnova Corporation H00004702B01

Catalog No. 89-005-835


Add to cart

Description

Description

The protein encoded by this gene belongs to the complex I 19kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq

Sequence: MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Specifications

Specifications

NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
Unconjugated
No additive
NM_014222.2
CI-19KD|CI-PGIV|MGC793|PGIV
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
4702
Western Blot
Mouse polyclonal antibody raised against a full-length human NDUFA8 protein.
NDUFA8
Serum
NDUFA8
NDUFA8 (NP_055037.1, 1 a.a. ~ 172 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit