NDUFV3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NDUFV3.

Manufacturer:  Abnova Corporation H00004731A01

Catalog No. 89-003-039

Description

The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and the reduction of ubiquinone. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKNVVEPKERGKLLATQTAAELSKNLSSPSSYPPAVNKGRKVASPS

Specifications

• Antigen: NDUFV3
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_021075
• Gene Alias: CI-9KD
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant NDUFV3.
• Gene: NDUFV3
• Format: Liquid
• Gene Symbols: NDUFV3
• Immunogen: NDUFV3 (NP_077718, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4731