Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NEFH, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NEFH.

Manufacturer:  Abnova Corporation H00004744A01

Catalog No. 89-003-041


Add to cart

Description

Description

Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and functionally maintain neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the heavy neurofilament protein. This protein is commonly used as a biomarker of neuronal damage and susceptibility to amyotrophic lateral sclerosis (ALS) has been associated with mutations in this gene. [provided by RefSeq

Sequence: LKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEA
Specifications

Specifications

NEFH
Unconjugated
50% glycerol
NM_021076
NFH
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant NEFH.
NEFH
Liquid
NEFH
NEFH (NP_066554, 263 a.a. ~ 363 a.a) partial recombinant protein with GST tag.
RUO
Primary
4744
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit