Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Nicotinic Acetylcholine R alpha 4/CHRNA4 Rabbit anti-Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179947

Catalog No. NBP179947


Add to cart

Description

Description

Nicotinic Acetylcholine R alpha 4/CHRNA4 Polyclonal antibody specifically detects Nicotinic Acetylcholine R alpha 4/CHRNA4 in Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

Nicotinic Acetylcholine R alpha 4/CHRNA4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CHRNA4
Synthetic peptide directed towards the N terminal of human CHRNA4. Peptide sequence ELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKW.
70 kDa
100 ul
Neuroscience
Primary
1137
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_000735
BFNC, cholinergic receptor, nicotinic, alpha 4, cholinergic receptor, nicotinic, alpha polypeptide 4, EBN, EBN1, ENFL1, FLJ95812, NACHR, NACHRA4, NACRA4, neuronal acetylcholine receptor subunit alpha-4, neuronal nicotinic acetylcholine receptor alpha-4 subunit
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Guinea pig: 85%; Rabbit: 78%.
Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only