Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Nicotinic Acetylcholine R alpha 7/CHRNA7 Rabbit anti-Human, Mouse, Rat, Bovine, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179948

Catalog No. NBP179948


Add to cart

Description

Description

Nicotinic Acetylcholine R alpha 7/CHRNA7 Polyclonal antibody specifically detects Nicotinic Acetylcholine R alpha 7/CHRNA7 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot.
Specifications

Specifications

Nicotinic Acetylcholine R alpha 7/CHRNA7
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CHRNA7
Synthetic peptide directed towards the N terminal of human CHRNA7. Peptide sequence QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV.
56 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 93%; Chicken: 93%.
Bovine, Human, Mouse, Rat
Western Blot
Western Blot 1:1000
NP_000737
a7 nicotinic acetylcholine receptor, alpha 7 neuronal nicotinic acetylcholine receptor, alpha-7 nicotinic cholinergic receptor subunit, cholinergic receptor, nicotinic, alpha 7, cholinergic receptor, nicotinic, alpha polypeptide 7, CHRNA7-2, NACHRA7, neuronal acetylcholine receptor protein, alpha-7 chain, neuronal acetylcholine receptor subunit alpha-7
Rabbit
IgG
Protein A purified
RUO
Primary
1139
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only