Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Nicotinic Acetylcholine Receptor epsilon Rabbit anti-Human, Mouse, Rat, Porcine, Guinea Pig, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179951

Catalog No. NBP179951


Add to cart

Description

Description

Nicotinic Acetylcholine Receptor epsilon Polyclonal antibody specifically detects Nicotinic Acetylcholine Receptor epsilon in Human, Mouse, Rat, Porcine, Guinea Pig samples. It is validated for Western Blot.
Specifications

Specifications

Nicotinic Acetylcholine Receptor epsilon
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CHRNE
Synthetic peptide directed towards the N terminal of human CHRNE. Peptide sequence GLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLIS.
55 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Mouse: 91%; Rat: 91%; Guinea pig: 84%; Pig: 80%.
Guinea Pig, Human, Mouse, Porcine, Rat
Western Blot
Western Blot 1:1000
NP_000071
acetylcholine receptor subunit epsilon, AchR epsilon subunit, ACHREFCCMS, cholinergic receptor, nicotinic, epsilon, cholinergic receptor, nicotinic, epsilon polypeptide, CMS1D, CMS1E, CMS2A, SCCMS
Rabbit
IgG
Protein A purified
RUO
Primary
1145
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only