Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nicotinic Acetylcholine Receptor epsilon Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP179951
Description
Nicotinic Acetylcholine Receptor epsilon Polyclonal specifically detects Nicotinic Acetylcholine Receptor epsilon in Human samples. It is validated for Western Blot.Specifications
Nicotinic Acetylcholine Receptor epsilon | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
acetylcholine receptor subunit epsilon, AchR epsilon subunit, ACHREFCCMS, cholinergic receptor, nicotinic, epsilon, cholinergic receptor, nicotinic, epsilon polypeptide, CMS1D, CMS1E, CMS2A, SCCMS | |
Rabbit | |
55 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Mouse: 91%; Rat: 91%; Guinea pig: 84%; Pig: 80%. | |
Human, Mouse, Rat, Porcine, Guinea Pig | |
IgG |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_000071 | |
CHRNE | |
Synthetic peptide directed towards the N terminal of human CHRNE. Peptide sequence GLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLIS. | |
Affinity Purified | |
RUO | |
1145 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction