Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

neuroligin 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NLGN1.

Manufacturer:  Abnova Corporation H00022871A01

Catalog No. 89-004-548


Add to cart

Description

Description

This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. [provided by RefSeq

Sequence: YSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELS
Specifications

Specifications

neuroligin 1
Unconjugated
50% glycerol
NM_014932
KIAA1070|MGC45115
Mouse
50 uL
Cell Adhesion
Y
Polyclonal
Human, Rat
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant NLGN1.
NLGN1
Serum
NLGN1
NLGN1 (NP_055747, 578 a.a. ~ 677 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
22871
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit