Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NLRP1/NALP1 Rabbit anti-Mouse, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154899

Catalog No. NBP154899


Add to cart

Description

Description

NLRP1/NALP1 Polyclonal antibody specifically detects NLRP1/NALP1 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen).
Specifications

Specifications

NLRP1/NALP1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
NLRP1
Synthetic peptides corresponding to NLRP1(NLR family, pyrin domain containing 1) The peptide sequence was selected from the N terminal of NLRP1 (NP_001028225). DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL.
155 kDa
100 ul
Apoptosis
Primary
22861
Bovine, Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit, Rat
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Frozen), Western Blot
Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
Q9C000
CARD7SLEV1, Caspase recruitment domain-containing protein 7, CLR17.1, Death effector filament-forming ced-4-like apoptosis protein, DEFCAPVAMAS1, DKFZp586O1822, KIAA0926DEFCAP-L/S, NACHT, leucine rich repeat and PYD (pyrin domain) containing 1, NACHT, leucine rich repeat and PYD containing 1, NACHT, LRR and PYD containing protein 1, NACHT, LRR and PYD domains-containing protein 1, NACPP1044, NALP1caspase recruitment domain protein 7, NLR family, pyrin domain containing 1, Nucleotide-binding domain and caspase recruitment domain, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only