Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

neuromedin U, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™ Available on GSA/VA Contract for Federal Government customers only.

Mouse polyclonal antibody raised against a full-length human NMU protein.

Manufacturer:  Abnova Corporation H00010874B01P

Catalog No. 89-017-014


  Check Availability
Add to cart

Specifications

Description

Sequence: CRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Description & Specifications

Specifications

neuromedin U
Unlabeled
neuromedin U
In 1X PBS, pH 7.4
BC012908
Murine
Protein A column
RUO
Human
Primary
10874
Western Blot
Human
Affinity Purified
NMU
NMU
NMU (AAH12908, 36 a.a. ∽175 a.a) full-length human protein.
50μg
Neurobiology
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit