Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-NOL1, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP192192

Catalog No. NBP192192


Add to cart

Description

Description

NOL1 Polyclonal antibody specifically detects NOL1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.
Specifications

Specifications

NOL1
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
NOP2
This antibody was developed against Recombinant Protein corresponding to amino acids:KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH
89 kDa
0.1 ml
Core ESC Like Genes, Stem Cell Markers
Primary
4839
Human, Mouse, Rat
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
P46087
EC 2.1.1, EC 2.1.1.-, MGC149287, MGC149288, NOL1/NOP2/Sun domain family, member 1, NOL1MGC117384, NOP120, NOP2 nucleolar protein homolog (yeast), NOP2/Sun domain family, member 1, NSUN1, Nucleolar protein 1, nucleolar protein 1 (120kD), nucleolar protein 1, 120kDa, Nucleolar protein 2 homolog, nucleolar protein 2 homolog (yeast), p120, Proliferating-cell nucleolar antigen p120, Proliferation-associated nucleolar protein p120, putative ribosomal RNA methyltransferase NOP2
Rabbit
IgG
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only