Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NT5M Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP192203
Description
NT5M Polyclonal specifically detects NT5M in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NT5M | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| 3'-nucleotidase, mitochondrialDNT2, 5', 5' nucleotidase, mitochondrial, 5(3)-deoxyribonucleotidase, Deoxy-5'-nucleotidase 2, dNT2, dNT-25'(3')-deoxyribonucleotidase, mitochondrial, EC 3.1.3, EC 3.1.3.-, mdN, mitochondrial 5' nucleotidase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| NT5M | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT | |
| 0.1 mL | |
| Lipid and Metabolism | |
| 56953 | |
| Human | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction