Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

numb homolog (Drosophila), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NUMB protein.

Manufacturer:  Abnova Corporation H00008650B01

Catalog No. 89-006-608


Add to cart

Description

Description

The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
Specifications

Specifications

numb homolog (Drosophila)
Unconjugated
No additive
BC033824
S171
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8650
Western Blot
Mouse polyclonal antibody raised against a full-length human NUMB protein.
NUMB
Serum
NUMB
NUMB (AAH33824, 1 a.a. ~ 135 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit