Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Orai1, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP185463

Catalog No. NBP185463


Add to cart

Description

Description

Orai1 Polyclonal antibody specifically detects Orai1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

Orai1
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
CRACM1ORAT1, FLJ14466, ORAI calcium release-activated calcium modulator 1, Protein orai-1, TMEM142Acalcium release-activated calcium modulator 1, Transmembrane protein 142Acalcium release-activated calcium channel protein 1
Rabbit
IgG
0.1 ml
Cancer, Neuroscience
Primary
84876
Human
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Affinity Purified
ORAI1
This antibody was developed against Recombinant Protein corresponding to amino acids:SLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only