anti-OXSM, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP184730

Catalog No. NBP184730

Description

OXSM Polyclonal antibody specifically detects OXSM in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OXSM
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 3-ketoacyl-acyl carrier protein synthase, 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial, 3-oxoacyl-ACP synthase, mitochondrial, acyl-malonyl acyl carrier protein-condensing enzyme, beta-ketoacyl synthase, Beta-ketoacyl-ACP synthase, EC 2.3.1, EC 2.3.1.41, FASN2D, FLJ20604, KASI, KS3-oxoacyl-acyl-carrier-protein synthase, type II mitochondrial beta-ketoacyl synthase
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 0.1 ml
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Format: Affinity Purified
• Gene Symbols: OXSM
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 54995
• Target Species: Human

For Research Use Only