Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PADI2 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154958

Catalog No. NBP154958


Add to cart

Description

Description

PADI2 Polyclonal antibody specifically detects PADI2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

PADI2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PADI2
Synthetic peptides corresponding to PADI2(peptidyl arginine deiminase, type II) The peptide sequence was selected from the middle region of PADI2. Peptide sequence RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV.
75 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Zebrafish: 83%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 0.2-1 ug/ml
Q9Y2J8
EC 3.5.3.15, KIAA0994PDI2PAD2, PAD-H19, peptidlyarginine deiminase type II, peptidyl arginine deiminase, type II, Peptidylarginine deiminase II, protein arginine deiminase, Protein-arginine deiminase type II, protein-arginine deiminase type-2
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
11240
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only