Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PAFAH1B3 protein.

Manufacturer:  Abnova Corporation H00005050B01

Catalog No. 89-005-903


Add to cart

Description

Description

This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq

Sequence: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Specifications

Specifications

platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
Unconjugated
No additive
NM_002573
PAFAH1B3
PAFAH1B3 (NP_002564.1, 1 a.a. ~ 231 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5050
Western Blot
Mouse polyclonal antibody raised against a full-length human PAFAH1B3 protein.
PAFAH1B3
Serum
Mouse
50 uL
Neurobiology
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit