Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

anti-Pannexin-3, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191566

Catalog No. NBP191566



Description

Description

Pannexin-3 Polyclonal antibody specifically detects Pannexin-3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Pannexin-3
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
PANX3
Synthetic peptide directed towards the middle region of human PANX3. Peptide sequence IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL.
Immunogen affinity purified
RUO
Primary
116337
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_443191
gap junction protein pannexin 3, pannexin 3, pannexin-3, PX3
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected to cross react based on sequence identity: Zebrafish: 86%.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only