Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

parvin, gamma, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PARVG protein.

Manufacturer:  Abnova Corporation H00064098B01

Catalog No. 89-008-053



Description

Description

Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM

Sequence: MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
Specifications

Specifications

parvin, gamma
Polyclonal
Mouse polyclonal antibody raised against a full-length human PARVG protein.
PARVG
PARVG
PARVG (NP_071424.1, 1 a.a. ∼ 331 a.a) full-length human protein.
RUO
Primary
Human
Western Blot
Unconjugated
No additive
NM_022141.4
Mouse
50 μL
Yes
64098
Serum
Safety and Handling

Safety and Handling

SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit