Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PCOLN3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PCOLN3 protein.

Manufacturer:  Abnova Corporation H00005119B01

Catalog No. 89-005-921


  Check Availability
Add to cart

Specifications

Description

This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. [provided by RefSeq

Sequence: MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
Description & Specifications

Specifications

chromatin modifying protein 1A
Unlabeled
chromatin modifying protein 1A
No additive
NM_002768.2
CHMP1A
PCOLN3 (NP_002759.2, 1 a.a. ∽196 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5119
Immunofluorescence,Western Blot
Human
Serum
CHMP1A
CHMP1, KIAA0047, PCOLN3, PRSM1
Murine
50μL
Human
Y
Polyclonal
Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit