PCOLN3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PCOLN3 protein.

Manufacturer: Abnova Corporation H00005119B02

Catalog No. 89-005-922

  Check Availability
Add to Cart

    Specifications

    Antigen chromatin modifying protein 1A
    Applications Immunofluorescence,Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description chromatin modifying protein 1A
    Format Serum
    Formulation No additive
    Gene CHMP1A
    Gene Accession No. BC007527
    Gene Alias CHMP1, KIAA0047, PCOLN3, PRSM1
    Gene Symbols CHMP1A
    Host Species Mouse
    Immunogen PCOLN3 (N/A, 1 a.a. ∽196 a.a) full-length human protein.
    Quantity 50μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Whole Molecule Y
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 5119

    This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. [provided by RefSeq

    Sequence: MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit