Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PCTAIRE1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP192248

Catalog No. NBP192248


Add to cart

Description

Description

PCTAIRE1 Polyclonal antibody specifically detects PCTAIRE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).
Specifications

Specifications

PCTAIRE1
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Cell division protein kinase 16, cyclin-dependent kinase 16, EC 2.7.11, EC 2.7.11.22, FLJ16665, PCTAIRE, PCTAIRE protein kinase 1, PCTAIRE1, PCTAIRE-motif protein kinase 1, PCTGAIRE, PCTK1Serine/threonine-protein kinase PCTAIRE-1
Rabbit
IgG
0.1 ml
Cell Cycle and Replication
Primary
5127
Human
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Affinity Purified
CDK16
This antibody was developed against Recombinant Protein corresponding to amino acids:MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of human PCTAIRE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only