phosphate cytidylyltransferase 2, ethanolamine, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PCYT2.

Manufacturer: Abnova Corporation H00005833A01

Catalog No. 89-004-276

  Check Availability
Add to Cart

    Specifications

    Antigen phosphate cytidylyltransferase 2, ethanolamine
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description phosphate cytidylyltransferase 2, ethanolamine
    Format Serum
    Formulation 50% glycerol
    Gene PCYT2
    Gene Accession No. NM_002861
    Gene Alias ET
    Gene Symbols PCYT2
    Host Species Mouse
    Immunogen PCYT2 (NP_002852, 25 a.a. ∽124 a.a) partial recombinant protein with GST tag.
    Quantity 50μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Whole Molecule Y
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 5833

    Sequence: VWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGR

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit