Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

phosphate cytidylyltransferase 2, ethanolamine, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PCYT2 protein.

Manufacturer:  Abnova Corporation H00005833B01

Catalog No. 89-006-106


  Check Availability
Add to cart

Specifications

Description

Sequence: MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF
Description & Specifications

Specifications

phosphate cytidylyltransferase 2, ethanolamine
Unlabeled
No additive
NM_002861.1
ET
Murine
50μL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5833
Western Blot
phosphate cytidylyltransferase 2, ethanolamine
PCYT2
Serum
PCYT2
PCYT2 (NP_002852.1, 1 a.a. ∽389 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit