Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PDK2 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154699

Catalog No. NBP154699


Add to cart

Description

Description

PDK2 Polyclonal antibody specifically detects PDK2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

PDK2
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
PDK2
Synthetic peptides corresponding to PDK2(pyruvate dehydrogenase kinase, isozyme 2) The peptide sequence was selected from the middle region of PDK2. Peptide sequence ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI.
44 kDa
100 ul
Protein Kinase
Primary
5164
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Q15119
EC 2.7.11, EC 2.7.11.2, lipoamide, kinase isozyme 2, mitochondrial, Pyruvate dehydrogenase kinase isoform 2, pyruvate dehydrogenase kinase, isoenzyme 2, pyruvate dehydrogenase kinase, isozyme 2
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Zebrafish: 77%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only