Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Peroxiredoxin 6 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155160

Catalog No. NBP155160


Add to cart

Description

Description

Peroxiredoxin 6 Polyclonal antibody specifically detects Peroxiredoxin 6 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

Peroxiredoxin 6
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PRDX6
Synthetic peptides corresponding to PRDX6(peroxiredoxin 6) The peptide sequence was selected from the C terminal of PRDX6. Peptide sequence VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP.
25 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
P30041
1-Cys, 24 kDa protein, Acidic calcium-independent phospholipase A2, aiPLA21-Cys PRX, Antioxidant protein 2, AOP2Non-selenium glutathione peroxidase, EC 1.11.1.15, EC 1.11.1.7, EC 3.1.1.-, KIAA0106Red blood cells page spot 12, Liver 2D page spot 40, MGC46173, NSGPx1-Cys peroxiredoxin, p29, peroxiredoxin 6, peroxiredoxin-6, PRX
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
9588
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only