Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PGD2 Synthase/PTGDS Rabbit anti-Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179280

Catalog No. NBP179280


Add to cart

Description

Description

PGD2 Synthase/PTGDS Polyclonal antibody specifically detects PGD2 Synthase/PTGDS in Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

PGD2 Synthase/PTGDS
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PTGDS
Synthetic peptide directed towards the N terminal of human PTGDSThe immunogen for this antibody is PTGDS (NP_000945). Peptide sequence MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS.
21 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Rabbit: 80%, Guinea pig: 79%.
Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
P41222
Beta-trace protein, cerebrin-28, EC 5.3.99.2, Glutathione-independent PGD synthase, glutathione-independent PGD synthetase, lipocalin-type prostaglandin D synthase, Lipocalin-type prostaglandin-D synthase, L-PGDS, PDS, PGD2, PGD2 synthase, PGDS2, PGDSLPGDS, prostaglandin D synthase, prostaglandin D2 synthase (21kD, brain), prostaglandin D2 synthase 21kDa (brain), Prostaglandin-D2 synthase, prostaglandin-H2 D-isomerase
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
5730
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only