Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PGK1 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155154

Catalog No. NBP155154


Add to cart

Description

Description

PGK1 Polyclonal antibody specifically detects PGK1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

PGK1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
PGK1
Synthetic peptides corresponding to PGK1(phosphoglycerate kinase 1) The peptide sequence was selected from the C terminal of PGK1 (NP_000282). Peptide sequence ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR.
44 kDa
100ul
Prostate Cancer
Primary
5230
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1.25 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
P00558
Cell migration-inducing gene 10 protein, EC 2.7.2.3, MGC142128, MGC8947, MIG10, PGKAMGC117307, phosphoglycerate kinase 1, Primer recognition protein 2, PRP 2
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only