Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

phosphatidylinositol glycan anchor biosynthesis, class M, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PIGM.

Manufacturer:  Abnova Corporation H00093183A01

Catalog No. 89-004-760


Add to cart

Description

Description

This gene encodes a transmembrane protein that is located in the endoplasmic reticulum and is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI)-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a mannosyltransferase, GPI-MT-I, that transfers the first mannose to GPI on the lumenal side of the endoplasmic reticulum. [provided by RefSeq

Sequence: YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK
Specifications

Specifications

phosphatidylinositol glycan anchor biosynthesis, class M
Unconjugated
50% glycerol
NM_145167
GPI-MT-I|MGC29896
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
93183
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PIGM.
PIGM
Serum
PIGM
PIGM (NP_660150, 35 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit