Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-PIMT, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP192271

Catalog No. NBP192271


Add to cart

Description

Description

PIMT Polyclonal antibody specifically detects PIMT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

PIMT
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Cap-specific guanine-N2 methyltransferase, CLL-associated antigen KW-2, DKFZp762A163, EC 2.1.1, EC 2.1.1.-, HCA137, Hepatocellular carcinoma-associated antigen 137, NCOA6IPSEREX-defined, nuclear receptor coactivator 6 interacting protein, Nuclear receptor coactivator 6-interacting protein, PIMTFLJ22995, PIPMT, PRIP-interacting protein PIPMT, PRIP-interacting protein with methyltransferase domain, PRIP-interacting protein with methyltransferase motif, trimethylguanosine synthase, trimethylguanosine synthase 1, trimethylguanosine synthase homolog, trimethylguanosine synthase homolog (S. cerevisiae)
Rabbit
IgG
0.1 ml
Transcription Factors and Regulators
Primary
96764
Human
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Affinity Purified
TGS1
This antibody was developed against Recombinant Protein corresponding to amino acids:PELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAE
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only