Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-PIWIL2, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals NBP154344

Catalog No. NBP154344

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Specifications

Specifications

PIWIL2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PIWIL2
Synthetic peptides corresponding to PIWIL2(piwi-like 2 (Drosophila)) The peptide sequence was selected from the N terminal of PIWIL2. Peptide sequence QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM.
110 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
Q8TC59
Cancer/testis antigen 80, CT80mili, FLJ10351, HILIMiwi like, MGC133049, Mili, PIWIL1L, piwil2-like protein, piwi-like 2 (Drosophila), piwi-like protein 2
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
55124
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only