Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PKA C beta Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155008

Catalog No. NBP155008


Add to cart

Description

Description

PKA C beta Polyclonal antibody specifically detects PKA C beta in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

PKA C beta
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PRKACB
Synthetic peptides corresponding to PRKACB(protein kinase, cAMP-dependent, catalytic, beta) The peptide sequence was selected from the middle region of PRKACB. Peptide sequence NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI.
40 kDa
100 ul
Protein Kinase, Signal Transduction, Wnt Signaling Pathway
Primary
5567
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
P22694
cAMP-dependent protein kinase catalytic beta subunit isoform 4ab, cAMP-dependent protein kinase catalytic subunit beta, DKFZp781I2452, EC 2.7.11, EC 2.7.11.11, MGC41879, MGC9320, PKA C-beta, PKACb, protein kinase A catalytic subunit beta, protein kinase, cAMP-dependent, catalytic, beta
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: beta.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only