pleiomorphic adenoma gene 1, Mouse, Clone: 3B7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PLAG1.

Supplier:  Abnova Corporation H00005324M02

Catalog No. 89-014-170

Description

Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK

Specifications

• Antigen: pleiomorphic adenoma gene 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002655
• Gene Symbols: PLAG1
• Immunogen: PLAG1 (NP_002646, 2 a.a. ∼ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Gene ID (Entrez): 5324
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3B7
• Description: Mouse monoclonal antibody raised against a partial recombinant PLAG1.
• Gene: PLAG1
• Gene Alias: PSA/SGPA
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody