Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

polymerase (RNA) III (DNA directed) polypeptide K, 12.3kDa (B02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human POLR3K protein.

Manufacturer:  Abnova Corporation H00051728B02

Catalog No. 89-007-704


Add to cart

Description

Description

This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. [provided by RefSeq

Sequence: MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Specifications

Specifications

polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Unconjugated
No additive
NM_016310.2
C11|C11-RNP3|My010|RPC10|RPC11|hRPC11
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
51728
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human POLR3K protein.
POLR3K
Serum
POLR3K
POLR3K (NP_057394.1, 1 a.a. ~ 108 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit