Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

POU class 6 homeobox 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human POU6F1 protein.

Manufacturer:  Abnova Corporation H00005463B01

Catalog No. 89-005-993


Add to cart

Description

Description

Sequence: MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Specifications

Specifications

POU class 6 homeobox 1
Unconjugated
No additive
BC074765.2
BRN5|MPOU|TCFB1
Mouse
50 uL
Transcription Regulation
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human POU6F1 protein.
POU6F1
Serum
POU6F1
POU6F1 (AAH74765.3, 1 a.a. ~ 301 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5463
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit