Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

peptidylprolyl isomerase (cyclophilin)-like 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PPIL1.

Manufacturer:  Abnova Corporation H00051645A01

Catalog No. 89-004-635


Add to cart

Description

Description

This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq

Sequence: SIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Specifications

Specifications

peptidylprolyl isomerase (cyclophilin)-like 1
Unconjugated
50% glycerol
NM_016059
CGI-124|CYPL1|MGC678|PPIase|hCyPX
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
51645
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PPIL1.
PPIL1
Serum
PPIL1
PPIL1 (NP_057143, 76 a.a. ~ 166 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit