Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-PPP2R2D, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP233379

Catalog No. NBP233379


Add to cart

Description

Description

PPP2R2D Polyclonal antibody specifically detects PPP2R2D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

PPP2R2D
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
PPP2R2D
This antibody was developed against a recombinant protein corresponding to amino acids: FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Q66LE6
KIAA1541, MDS026, PP2A subunit B isoform B55-delta, PP2A subunit B isoform delta, PP2A subunit B isoform PR55-delta, PP2A subunit B isoform R2-delta, protein phosphatase 2, regulatory subunit B, delta, protein phosphatase 2, regulatory subunit B, delta isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B deltaisoform
Rabbit
IgG
0.1 ml
Protein Phosphatase
Primary
55844
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only