Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-PPP2R5C, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals NBP152915

Catalog No. NBP152915

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Specifications

Specifications

PPP2R5C
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PPP2R5C
Synthetic peptides corresponding to PPP2R5C(protein phosphatase 2, regulatory subunit B', gamma isoform) The peptide sequence was selected from the middle region of PPP2R5C (NP_848703). Peptide sequence RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIY
45 kDa
100 ul
Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Neuronal Cell Markers, Neuroscience, Neurotransmission, Protein Phosphatase, Signal Transduction, Wnt Signaling Pathway
Primary
5527
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 0.2-1 ug/ml
Q96B13
B' alpha regulatory subunit, B56G, KIAA0044, MGC23064, PP2A B subunit isoform B56-gamma, PP2A B subunit isoform B'-gamma, PP2A B subunit isoform PR61-gamma, PP2A B subunit isoform R5-gamma, PR61G, protein phosphatase 2, regulatory subunit B (B56), gamma isoform, protein phosphatase 2, regulatory subunit B', gamma, protein phosphatase 2, regulatory subunit B', gamma isoform, Renal carcinoma antigen NY-REN-29, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to the gamma isoform.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only