Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PRELP Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179627

Catalog No. NBP179627


Add to cart

Description

Description

PRELP Polyclonal antibody specifically detects PRELP in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

PRELP
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PRELP
Synthetic peptide directed towards the middle region of human PRELPThe immunogen for this antibody is PRELP. Peptide sequence SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH.
Immunogen affinity purified
RUO
Primary
5549
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_002716
55 kDa leucine-rich repeat protein of articular cartilage, MST161, MSTP161, prolargin, prolargin proteoglycan, proline arginine-rich end leucine-rich repeat protein, proline/arginine-rich end leucine-rich repeat protein, Proline-arginine-rich end leucine-rich repeat protein, SLRR2AMGC45323
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%; Bovine: 85%; Canine: 85%; Guinea pig: 85%; Rabbit: 85%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only