Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PRMT2 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152944

Catalog No. NBP152944


Add to cart

Description

Description

PRMT2 Polyclonal antibody specifically detects PRMT2 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

PRMT2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
PRMT2
Synthetic peptides corresponding to PRMT2 (protein arginine methyltransferase 2) The peptide sequence was selected from the N terminal of PRMT2 (NP_001526). Peptide sequence ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL.
48 kDa
100ul
Apoptosis, Chromatin Research
Primary
3275
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 0.625 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
P55345
EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT2, HMT1, HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1, HMT1 hnRNP methyltransferase-like 1, HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae), HRMT1L1PRMT2 beta, MGC111373, PRMT2 alpha, PRMT2 gamma, protein arginine methyltransferase 2, protein arginine N-methyltransferase 2
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only